PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family TALE
Protein Properties Length: 387aa    MW: 43131.1 Da    PI: 6.8363
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030003genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.79.3e-093043382155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps++++  LA+ +gL+++q+ +WF N+R ++
  Lus10030003 304 KWPYPSETQKVALAEATGLDQKQINNWFINQRKRH 338
                  569*****************************885 PP

2ELK36.88.2e-13258279122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlr YsgyLg+LkqEF+
  Lus10030003 258 ELKVQLLRRYSGYLGNLKQEFL 279
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012550.0013117162IPR005540KNOX1
PfamPF037902.6E-10119161IPR005540KNOX1
SMARTSM012569.0E-25161212IPR005541KNOX2
PfamPF037912.3E-20165211IPR005541KNOX2
PfamPF037893.1E-9258279IPR005539ELK domain
PROSITE profilePS5121310.964258278IPR005539ELK domain
SMARTSM011881.6E-6258279IPR005539ELK domain
PROSITE profilePS5007112.665278341IPR001356Homeobox domain
SMARTSM003892.0E-12280345IPR001356Homeobox domain
SuperFamilySSF466891.07E-19280355IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28283343IPR009057Homeodomain-like
CDDcd000866.03E-12290341No hitNo description
PfamPF059206.8E-17298337IPR008422Homeobox KN domain
PROSITE patternPS000270316339IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MESGRTAEVC GGGILMGLSN PHRNGIMMIQ QQQHSSNSTP SSSPSSSHSS MDMVTNNNPL  60
PSPYYFMDSN NFISTSISAS LPPTDPHETQ TLTLPNNTNL LPLPPTTNTS SSTSSGVSMR  120
AKIMSHPHFP RLLSAFSNCQ KEEACGGDAP PAAAAMMSGA RTSSLGEDPA LDQFMEAYCE  180
MLTKYEQELS KPFKEALIFL SRIESQFRAL TTTNSSSSPN YNSAQGSGDM ANGRNGSSEE  240
DIEAMEATYI DPQAEDKELK VQLLRRYSGY LGNLKQEFLK KKKKGKLPKE ARQMLLEWWN  300
RHYKWPYPSE TQKVALAEAT GLDQKQINNW FINQRKRHWK PTEDMQFVVM DAANYPHYYL  360
ENGGNSFPLD FNSSSSHHHN HHHQHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8854351e-141HQ885435.1 Linum usitatissimum clone Contig1323 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.11e-117PREDICTED: homeobox protein SBH1
SwissprotP466081e-110HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB9RXF11e-117B9RXF1_RICCO; Homeobox protein knotted-1, putative
STRINGVIT_12s0059g01190.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.12e-94KNOX/ELK homeobox transcription factor